| Title | Structural basis for recognition of the tra mRNA precursor by the Sex-lethal protein. Nature 398 579-585 1999 | | Site | RSGI | | PDB Id | | Target Id | trt001000189.1 | | Molecular Characteristics | | Source | Drosophila melanogaster | | Alias Ids | TPS14094, | Molecular Weight | 18946.57 Da. | | Residues | 168 | Isoelectric Point | 9.57 | | Sequence | asntnlivnylpqdmtdrelyalfraigpintcrimrdyktgysygyafvdftsemdsqraikvlngit vrnkrlkvsyarpggesikdtnlyvtnlprtitddqldtifgkygsivqknilrdkltgrprgvafvry nkreeaqeaisalnnvipeggsqplsvrla | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 2.60 | Rfree | 0.2940000 | | Matthews' coefficent | 2.80 | Rfactor | 0.2010000 | | Waters | 84 | Solvent Content | 59.00 |
| Ligand Information | | Ligands | | | Metals | | | |
