| Title | The N-terminal domain of the human Rad51 protein binds DNA: structure and a DNA binding surface as revealed by NMR. J.Mol.Biol. 290 495-504 1999 | | Site | RSGI | | PDB Id | | Target Id | trt001000204.1 | | Molecular Characteristics | | Source | Homo sapiens | | Alias Ids | TPS14098, | Molecular Weight | 12531.64 Da. | | Residues | 114 | Isoelectric Point | 5.05 | | Sequence | mamqmqleanadtsveeesfgpqpisrleqcginandvkkleeagfhtveavayapkkelinikgisea kadkilaeaaklvpmgfttatefhqrrseiiqittgskeldkllq | | | BLAST FFAS | | Structure Determination | | Method | NMR | Chains | 1 |
| Ligand Information | | Ligands | | | Metals | | | |
