| Title | An interaction between a specified surface of the C-terminal domain of RecA protein and double-stranded DNA for homologous pairing. J.Mol.Biol. 274 213-221 1997 | | Site | RSGI | | PDB Id | | Target Id | my_001000015.1 | | Molecular Characteristics | | Source | Escherichia coli | | Alias Ids | TPS13678, | Molecular Weight | 7096.78 Da. | | Residues | 63 | Isoelectric Point | 8.15 | | Sequence | infygelvdlgvkekliekagawysykgekigqgkanatawlkdnpetakeiekkvrelllsn | | | BLAST FFAS | | Structure Determination | | Method | NMR | Chains | 1 |
| Ligand Information | | Ligands | | | Metals | | | |
