.
The Open Protein Structure Annotation Network
PDB Keyword
.

2iss

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural Insights into the Mechanism of the PLP Synthase Holoenzyme from Thermotoga maritima. Biochemistry 45 14609-14620 2006
    Site OTHER
    PDB Id 2iss Target Id PDB2ISS
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS26065, TM0472 Molecular Weight 34288.25 Da.
    Residues 313 Isoelectric Point 6.62
    Sequence mgsshhhhhhssglvprgshmeikkgtwiikkgfaemfkggvimdvtsaeqakiaeeagavavmalervp adirkeggvarmasiakireimeavsipvmakvrighiaeakileelgvdfidesevltpaddrfhink hefkvpfvcgardlgealrriaegaamirtkgeagtgnvveavkhmrrvmeqikqvtkmedeelvaygk eigapvellrevkrlgrlpvvnfaaggvatpadaalmmmlgadgvfvgsgifkskdprkmakamvlavt ywdnprillkisedigepmrgldveelevrmqergw
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.90 Rfree 0.236
    Matthews' coefficent 3.02 Rfactor 0.213
    Waters 38 Solvent Content 59.22

    Pathway

    Reactions found in Metabolic Reconstruction for TM0473TM0472

    Name: Pyridoxal-5-phosphate synthase
    Genes involved in rxn:TM0472 TM0473
    Metabolic Subsystem: Vitamin B6 Metabolism
    Reaction: : g3p + gln-L + r5p --> glu-L + h + h2o + pi + pydx5p

     

    Ligand Information
    Ligands 5RP (RIBULOSE-5-PHOSPHATE) x 3;PO4 (PHOSPHATE) x 3
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch