| Title | Structural analysis of a periplasmic binding protein in the tripartite ATP-independent transporter family reveals a tetrameric assembly that may have a role in ligand transport. J.Biol.Chem. 283 32812-32820 2008 | | Site | OTHER | | PDB Id | | Target Id | PDB2HPG | | Molecular Characteristics | | Source | Thermotoga maritima | | Alias Ids | TPS26093, TM0322 | Molecular Weight | 37270.08 Da. | | Residues | 327 | Isoelectric Point | 6.11 | | Sequence | msavfgakytlrfghvlapgepyhqaflkwakaveektngdvrievfpssqlgveediieqirmgapvgw ntdsarlgmyvkdigvmnlayfidfmgaktpeeaievlkkikqsptmqkwlkeleqrfgikvlsfywvq gyrhfvtnkpirkpedlnglrirtpgapawqesirslgaipvavnfgeiytavqtravdgaeltyanvy ngglyevlkymsetghfllinfeivsadwfnslpkeyqkiieeemdkagievslkimkeleeeykqkci ekgmavipaseidkeafmekakqayknlglenalnqlikevkgehhhhhh | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 4 | | Resolution (Å) | 1.90 | Rfree | 0.239 | | Matthews' coefficent | 2.91 | Rfactor | 0.213 | | Waters | 529 | Solvent Content | 57.72 |
| Ligand Information | | Ligands | | | Metals | | | |
