.
The Open Protein Structure Annotation Network
PDB Keyword
.

2gha

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title T. maritima maltotriose binding protein. To be Published
    Site OTHER
    PDB Id 2gha Target Id PDB2GHA
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS26061, TM1204 Molecular Weight 42175.22 Da.
    Residues 382 Isoelectric Point 5.04
    Sequence mqpkltiwcsekqvdilqklgeefkakygvevevqyvnfqdikskfltaapegqgadiivgahdwvgela vngliepipnfsdlknfyetalnafsyggklygipyameaialiynkdyvpeppktmdelieiakqide efggevrgfitsaaefyyiapfifgyggyvfkqtekgldvndiglanegaikgvkllkrlvdegildps dnyqimdsmfregqaamiingpwaikaykdagidygvapipdlepgvparpfvgvqgfmvnakspnkll aiefltsfiakketmyriylgdprlpsrkdvlelvkdnpdvvgftlsaangipmpnvpqmaavwaamnd alnlvvngkatveealknaverikaqiqgshhhhhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.60 Rfree 0.196
    Matthews' coefficent 2.07 Rfactor 0.162
    Waters 707 Solvent Content 40.46

    Pathway

    Reactions found in Metabolic Reconstruction for TM1204

    Name: D-glucose transport via ABC system
    Other genes that carryout this rxn: TM1202 TM1203
    Metabolic Subsystem: Transport
    Reaction: atp[c] + glc-D[e] + h2o[c] --> adp[c] + glc-D[c] + h[c] + pi[c]

     
    Name: Maltotriose transport via ABC system
    Other genes that carryout this rxn: TM1202 TM1203 TM1837 TM1836 TM1839
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + malttr[e] --> adp[c] + h[c] + malttr[c] + pi[c]

     
    Name: maltotetraose transport via ABC system
    Other genes that carryout this rxn: TM1202 TM1203
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + maltttr[e] --> adp[c] + h[c] + maltttr[c] + pi[c]

     
    Name: maltose transport via ABC system
    Other genes that carryout this rxn:TM1837 TM1836 TM1839 TM1202 TM1203
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + malt[e] --> adp[c] + h[c] + malt[c] + pi[c]

     
    Name: D-galactose transport via ABC system
    Other genes that carryout this rxn: TM1202 TM1203
    Metabolic Subsystem: Transport
    Reaction: atp[c] + gal[e] + h2o[c] --> adp[c] + gal[c] + h[c] + pi[c]

     
    Name: Laminoribiose transport via ABC-transporter
    Other genes that carryout this rxn:TM0028 TM0030 TM0029 TM0027 TM0031 T
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + lmn2[e] --> adp[c] + h[c] + lmn2[c] + pi[c]

     
    Name: raffinose transport via ABC system (import)
    Other genes that carryout this rxn: TM1202 TM1203
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + raffin[e] --> adp[c] + h[c] + pi[c] + raffin[c]

     
    Name: melibiose transport via ABC system (import)
    Other genes that carryout this rxn: TM1202 TM1203
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + melib[e] --> adp[c] + h[c] + melib[c] + pi[c]

     

    Ligand Information
    Ligands MLR (MALTOTRIOSE) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch