.
The Open Protein Structure Annotation Network
PDB Keyword
.
Blog
Tools
About
Logged in: Logged in as: Log in
Register

New Features

Quick Links

 

T. maritima Browser

TOPSAN > Proteins > OTHER > 1a0e

1a0e

    Page last modified 23:49, 22 Mar 2010 by dweekes
    Email link
    Page Notifications Off
    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structures of Class II Xylose Isomerases from Two Thermophiles and a Hyperthermophile. To be Published
    Site OTHER
    PDB Id 1a0e Target Id PDB1A0E
    Molecular Characteristics
    Source Thermotoga neapolitana
    Alias Ids TPS18693, TM1667 Molecular Weight 50759.11 Da.
    Residues 443 Isoelectric Point 5.47
    Sequence aeffpeipkvqfegkestnplafkfydpeeiidgkplkdhlkfsvafwhtfvnegrdpfgdptadrpwnr ytdpmdkafarvdalfefceklnieyfcfhdrdiapegktlretnkildkvverikermkdsnvkllwg tanlfshprymhgaattcsadvfayaaaqvkkaleitkelggegyvfwggregyetllntdlgfelenl arflrmavdyakrigftgqfliepkpkeptkhqydfdvatayaflkshgldeyfkfnieanhatlaght fqhelrmarilgklgsidanqgdlllgwdtdqfptnvydttlamyevikaggftkgglnfdakvrrasy kvedlfighiagmdtfalgfkvayklvkdgvldkfieekyrsfregigrdivegkvdfekleeyiidke tielpsgkqeyleslinsyivktilelr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.70 Rfree 0.2030000
    Matthews' coefficent 2.40 Rfactor 0.1800000
    Waters 256 Solvent Content 50.00

    Pathway

    Reactions found in Metabolic Reconstruction for TM1667
    Name: xylose isomerase
    Metabolic Subsystem: Fructose Metabolism
    Reaction: : glc-D <==> fru
    Classification: EC:5.3.1.5
     
    Name: xylose isomerase
    Metabolic Subsystem: Xylan Metabolism
    Reaction: : xyl-D <==> xylu-D
    Classification: EC:5.3.1.5
     

    Ligand Information
    Ligands
    Metals CO (COBALT) x 6

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews References Images Files Tags

    Reviews

    References

     

    No references found.

    Add tag
    Tag page
    • No tags
    What links here
    Attach file or image

    Files (0)

     
    Attach file or image

    Images (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch