| Title | Crystal Structure of Methyl Transferase from Methanosarcina mazei. To be Published | | Site | NYSGXRC | | PDB Id | | Target Id | NYSGXRC-11121h | | Molecular Characteristics | | Source | Methanosarcina mazei | | Alias Ids | TPS53438,NP_633973.1, 3.40.50.150 | Molecular Weight | 29971.83 Da. | | Residues | 266 | Isoelectric Point | 5.56 | | Sequence | mteyvhgyserealrlseqaetlekllhhdtvyppgakvleagcgigaqtvilaknnpdaeitsidisp eslekarentekngiknvkflqanifslpfedssfdhifvcfvlehlqspeealkslkkvlkpggtitv iegdhgscyfhpegkkaieawnclirvqaymkgnslvgrqiypllqesgfekirveprmvyidsskpel vdgfilktiipmvegvkeqslkmqiikeeewekgieelhktaehggtfcytffkgwgtk | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 1.86 | Rfree | 0.239 | | Matthews' coefficent | 2.46 | Rfactor | 0.214 | | Waters | 312 | Solvent Content | 50.04 |
| Ligand Information | | Ligands | | | Metals | | | |
