| Title | Crystal structure of metallo peptidase from Rhodobacter sphaeroides liganded with phosphinate mimic of dipeptide L-Ala-D-Ala. To be Published | | Site | NYSGXRC | | PDB Id | | Target Id | NYSGXRC-9523c | | Molecular Characteristics | | Source | Rhodobacter sphaeroides | | Alias Ids | TPS33311,PF01244, 83369749 | Molecular Weight | 38756.93 Da. | | Residues | 355 | Isoelectric Point | 6.04 | | Sequence | msdtipvfdghndfllrllrnpanretiwlrgdgtghldlprmkaggfaggffaiyipspqahdsadfe ammnnppfdlplpalirheqaqpvalamaghllwmeraargrfkvcrtvadlrschaegivsgimhmeg aeaigadldalhlfhslglrslgpvwsrptvfghgvpfrfpgtpdtgsgltdagrrlvaecnrlkimld lshlnqkgfedvaglsdaplvathsnahavtpstrnltdrqldairesrgmvglnfatsflredgrqsp emgwepvlrhldhligrlgedhvglgsdfdgatipqgigdvtglpalqaalrahgydealmrklchenw yavlertwga | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 1.40 | Rfree | 0.1920 | | Matthews' coefficent | 2.11 | Rfactor | 0.1693 | | Waters | 638 | Solvent Content | 41.76 |
| Ligand Information | | Ligands | LY0 ((2R)-3-[(R)-[(1R)-1-AMINOETHYL](HYDROXY)PHOSPHORYL]-2-) x 2 | | Metals | ZN (ZINC) x 4 | | |
