| Title | Crystal structure of a Signal receiver domain of Two component Signal Transduction (Histidine Kinase) from Clostridium thermocellum. To be Published | | Site | NYSGXRC | | PDB Id | | Target Id | NYSGXRC-11201g | | Molecular Characteristics | | Source | Clostridium thermocellum | | Alias Ids | TPS33372,ABN54281.1, 3.30.70.270, PF00072 | Molecular Weight | 35112.42 Da. | | Residues | 308 | Isoelectric Point | 6.78 | | Sequence | mdgtvllidyfeyerektkiifdnigeydfievenlkkfysifkdldsitliimdiafpvekeglevls airnnsrtantpviiatksdnpgyrhaalkfkvsdyilkpyptkrlensvrsvlkicqrfryefdsahv ismsiedyiskefkvasragqslsvilmapvglekepseqstqisselqdqiqnlaiekvklslrstdt ailnanrdilvilpftnaagaqkvlqkiqdnvreglkslninyddyyyavsvtfpndgktfqslmekav kkvedkimlekitsigvnildnarnsykkfnk | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 2.40 | Rfree | 0.267 | | Matthews' coefficent | 2.64 | Rfactor | 0.234 | | Waters | 53 | Solvent Content | 53.33 |
| Ligand Information | | Ligands | | | Metals | | | |
