| Title | Crystal structure of putative geranyltranstransferase from Pseudomonas fluorescens PF-5 complexed with magnesium. To be Published | | Site | NYSGXRC | | PDB Id | | Target Id | NYSGXRC-20027b | | Related PDB Ids 3lji | | Molecular Characteristics | | Source | Pseudomonas fluorescens | | Alias Ids | TPS31608,70732810, PF00348 | Molecular Weight | 31394.86 Da. | | Residues | 295 | Isoelectric Point | 5.30 | | Sequence | mitayqassqarvdaamhtlftapspelarlyeamrysvmnggkrvrpllayaacealggkpeqangaa cavelihayslvhddlpamddddlrrgqptthkafdeacailagdglqslafsalldpalsdasaeirl rmvttlaqaagpagmvggqaidlgsvglkldqqaleymhrhktgalieasvilgalasgraekgelkal qtyaqaiglafqvqddildvesdtatlgkrqgadiardkptypallglaaakeyalelrdqalhalrpf daaaeplrelaryiverrs | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 1.35 | Rfree | 0.201 | | Matthews' coefficent | 2.00 | Rfactor | 0.179 | | Waters | 256 | Solvent Content | 38.45 |
| Ligand Information | | Ligands | | | Metals | MG (MAGNESIUM) x 3 | | |
