.
The Open Protein Structure Annotation Network
PDB Keyword
.
Blog
Tools
About
Logged in: Logged in as: Log in
Register

New Features

Quick Links

 

T. maritima Browser

TOPSAN > Proteins > NYSGXRC > 3e9v

3e9v

    Page last modified 07:36, 25 Sep 2010 by Admin
    Email link
    Page Notifications Off
    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of human B-cell Translocation Gene 2 (BTG2). To be Published
    Site NYSGXRC
    PDB Id 3e9v Target Id NYSGXRC-13011a
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS24492,NP_006754.1, PF07742 Molecular Weight 17415.12 Da.
    Residues 158 Isoelectric Point 8.29
    Sequence mshgkgtdmlpeiaaavgflssllrtrgcvseqrlkvfsgalqealtehykhhwfpekpskgsgyrcir inhkmdpiisrvasqiglsqpqlhqllpseltlwvdpyevsyrigedgsicvlyeeaplaascglltck nqvllgrsspsknyvmavss
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.248
    Matthews' coefficent 1.84 Rfactor 0.211
    Waters 66 Solvent Content 33.31

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 2
    Metals

    Jmol

     
    Google Scholar output for 3e9v
    1. Structural basis for the antiproliferative activity of the Tob-hCaf1 complex
    M Horiuchi, K Takeuchi, N Noda, N Muroya - Journal of Biological , 2009 - ASBMB
     

    Protein Summary


    Ligand Summary

    Reviews References Images Files Tags

    Reviews

    References

     

    No references found.

    Add tag
    Tag page
    • No tags
    What links here
    Attach file or image

    Files (0)

     
    Attach file or image

    Images (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch