2rjz

Page last modified 10:44, 25 Sep 2010 by Admin

Email link

Summary Discussions

Molecular Characteristics
Title	Periplasmic domains of Pseudomonas aeruginosa PilN and PilO form a stable heterodimeric complex. J.Mol.Biol. 394 143-159 2009
Site	NYSGXRC
PDB Id	2rjz	Target Id	NYSGXRC-10146c
Source	Pseudomonas aeruginosa
Alias Ids	TPS7979,Q51353, PF04350	Molecular Weight	22817.99 Da.
Residues	207	Isoelectric Point	5.04
Sequence	mslassleslrkidindldlnnigswpaavkvivcvlltaavlalgynfhlsdmqaqleqqaaeeetlk qqfstkafqaanleaykaqmkemeesfgallrqlpsdtevpglleditrtglgsglefeeikllpevaq qfyielpiqisvvggyhdlatfvsgvsslprivtlhdfeikpvapgstsklrmsilaktyryndkglkk
	BLAST FFAS

Ligand Information
Ligands	SO4 (SULFATE) x 4
Metals

Google Scholar output for 2rjz
1. Periplasmic domains of Pseudomonas aeruginosa PilN and PilO form a stable heterodimeric complex
LM Sampaleanu, JB Bonanno, M Ayers, J Koo - Journal of molecular , 2009 - Elsevier

2. How Pseudomonas aeruginosa Twitches: Type IV Pili at Work
L Burrows - Annual Review of Microbiology, 2012 - annualreviews.org

Reviews References Images Files Tags

Reviews

No references found.

Add tag

Tag page

What links here

Attach file or image

Images 0
No images to display in the gallery.

You must login to post a comment.

All content on this site is licensed under a Creative Commons Attribution 3.0 License