| Title | Crystal structure of the uncharacterized protein yfeY from Escherichia coli. To be Published | | Site | NYSGXRC | | PDB Id | | Target Id | NYSGXRC-10326a | | Molecular Characteristics | | Source | Escherichia coli | | Alias Ids | TPS8016,PF06572, P76537 | Molecular Weight | 20896.50 Da. | | Residues | 191 | Isoelectric Point | 5.21 | | Sequence | mkslrlmlcamplmltgcstmssvnwsaanpwnwfgsstkvseqgvgeltastplqeqaiadaldgdyr lrsgmktangnvvrffevmkgdnvamvingdqgtisridvldsdipadtgvkigtpfsdlyskafgncq kadgddnraveckaegsqhisyqfsgewrgpeglmpsddtlknwkvskiiwrr | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 2.10 | Rfree | 0.296 | | Matthews' coefficent | 2.05 | Rfactor | 0.217 | | Waters | 113 | Solvent Content | 39.90 |
| Ligand Information | | Ligands | | | Metals | | | |
