.
The Open Protein Structure Annotation Network
PDB Keyword
.
Blog
Tools
About
Logged in: Logged in as: Log in
Register

New Features

Quick Links

 

T. maritima Browser

TOPSAN > Proteins > NYSGXRC > 2pag

2pag

    Page last modified 11:03, 25 Sep 2010 by Admin
    Email link
    Page Notifications Off
    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of conserved hypothetical protein from Pseudomonas syringae pv. tomato. To be Published
    Site NYSGXRC
    PDB Id 2pag Target Id NYSGXRC-10412i
    Molecular Characteristics
    Source Pseudomonas syringae pv. tomato
    Alias Ids TPS8036,Q87TZ9_PSESM, BIG_91 Molecular Weight 15592.56 Da.
    Residues 135 Isoelectric Point 3.70
    Sequence veevieqlreanepvpvplelpdedqlveieeqlfinipfvfkeflltvsdvvygslepvtvtdpqsht ylpevcatawdlgvprelipicqdgedyycveedgtvllwsaeeelvteeswesvwhwardvwles
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.60 Rfree 0.222
    Matthews' coefficent 2.20 Rfactor 0.233
    Waters 133 Solvent Content 44.21

    Ligand Information
    Ligands
    Metals CA (CALCIUM) x 2

    Jmol

     
    Google Scholar output for 2pag
    1. A novel immunity system for bacterial nucleic acid degrading toxins and its recruitment in various eukaryotic and DNA viral systems
    D Zhang, LM Iyer, L Aravind - Nucleic acids research, 2011 - Oxford Univ Press
     

    Protein Summary


    Ligand Summary

    Reviews References Images Files Tags

    Reviews

    References

     

    No references found.

    Add tag
    Tag page
    • No tags
    What links here
    Attach file or image

    Files (0)

     
    Attach file or image

    Images (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch