.
The Open Protein Structure Annotation Network
PDB Keyword
.

2nw5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural basis of inhibition of an Encephalitozoon cuniculi Methionine Aminopeptidase Type 2. To be Published
    Site NYSGXRC
    PDB Id 2nw5 Target Id NYSGXRC-9201a
    Related PDB Ids 3cmk 3d0d 
    Molecular Characteristics
    Source Encephalitozoon cuniculi
    Alias Ids TPS7769,NP_586190, PF00557 Molecular Weight 39973.33 Da.
    Residues 358 Isoelectric Point 5.97
    Sequence mkcillnqaeelpieflpkdgvygkgklfdsrnmeienftesdilqdarraaeahrraryrvqsivrpg itlleivrsiedstrtllkgernngigfpagmsmnscaahytvnpgeqdivlkeddvlkidfgthsdgr imdsaftvafkenlepllvaaregtetgikslgvdvrvcdigrdinevissyeveiggrmwpirpisdl hghsisqfrihggisipavnnrdttrikgdsfyavetfattgkgsiddrppcshfvlntyksrklfnkd likvyefvkdslgtlpfsprhldyyglvkggslksvnlltmmglltpypplndidgckvaqfehtvyls ehgkevltrgddy
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.18 Rfree 0.245
    Matthews' coefficent 2.40 Rfactor 0.185
    Waters 324 Solvent Content 48.65

    Ligand Information
    Ligands SO4 (SULFATE) x 3
    Metals CO (COBALT) x 4

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch