.
The Open Protein Structure Annotation Network
PDB Keyword
.

2imo

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural Analysis of a Ternary Complex of Allantoate Amidohydrolase from Escherichia coli Reveals its Mechanics. J.Mol.Biol. 368 450-463 2007
    Site NYSGXRC
    PDB Id 2imo Target Id NYSGXRC-3055c
    Related PDB Ids 1z2l 
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS7746,NP_415049.1, PF01546 Molecular Weight 45560.43 Da.
    Residues 410 Isoelectric Point 5.24
    Sequence ithfrqaieetlpwlssfgadpaggmtrllyspewletqqqfkkrmaasgletrfdevgnlygrlngte ypqevvlsgshidtvvnggnldgqfgalaawlaidwlktqygaplrtvevvamaeeegsrfpyvfwgsk nifglanpddvrnicdakgnsfvdamkacgftlpnapltprqdikafvelhieqgcvlesngqsigvvn aivgqrrytvtlngesnhagttpmgyrrdtvyafsrichqsvekakrmgdplvltfgkveprpntvnvv pgkttftidcrhtdaavlrdftqqlendmraicdemdigididlwmdeepvpmnkelvatltelcerek lnyrvmhsgaghdaqifaprvptcmifipsingishnpaertnitdlaegvktlalmlyqlawqk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.80 Rfree 0.302
    Matthews' coefficent 2.22 Rfactor 0.245
    Waters 57 Solvent Content 44.69

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2imo
    1. Structural Analysis of a Ternary Complex of Allantoate Amidohydrolase from Escherichia coli Reveals its Mechanics
    R Agarwal, SK Burley, S Swaminathan - Journal of molecular biology, 2007 - Elsevier
     
    2. Mutational and structural analysis of LN-carbamoylase: new insights into a peptidase M20/M25/M40 family member.
    S Martnez-Rodrguez, A Garca-Pino - Journal of , 2012 - Am Soc Microbiol
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch