.
The Open Protein Structure Annotation Network
PDB Keyword
.

2hzt

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of a putative HTH-type transcription regulator ytcD. To be Published
    Site NYSGXRC
    PDB Id 2hzt Target Id NYSGXRC-2785g
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS7743,PF01638, NP_390781.1 Molecular Weight 14362.91 Da.
    Residues 125 Isoelectric Point 7.95
    Sequence ekkkynisveatleviggkwkcvilchlthgkkrtselkrlmpnitqkmltqqlreleadgvinrivyn qvppkveyelseygrslegildmlcawganhinrvygdtfsvleesvlndklkqes
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.00 Rfree 0.282
    Matthews' coefficent 2.32 Rfactor 0.236
    Waters 240 Solvent Content 46.99

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2hzt
    1. Homology modeling, docking studies and functional analysis of various azoreductase accessory interacting proteins of Nostoc sp. PCC7120
    PD Philem, S Adhikari - Bioinformation, 2012 - ncbi.nlm.nih.gov
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch