.
The Open Protein Structure Annotation Network
PDB Keyword
.

2hdw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of hypothetical protein PA2218 from Pseudomonas Aeruginosa. To be Published
    Site NYSGXRC
    PDB Id 2hdw Target Id NYSGXRC-2896c
    Molecular Characteristics
    Source Pseudomonas aeruginosa
    Alias Ids TPS7745,NP_250908.1, PF01738 Molecular Weight 40261.44 Da.
    Residues 366 Isoelectric Point 7.96
    Sequence etkhsnrarsrkgalrgavlagalmalvgcqtspaattssntggtnmqlqltqewdktfplsakvehrk vtfanrygitlaadlylpknrggdrlpaiviggpfgavkeqssglyaqtmaergfvtlafdpsytgesg gqprnvaspdintedfsaavdfisllpevnrerigvigicgwggmalnavavdkrvkavvtstmydmtr vmskgyndsvtleqrtrtleqlgqqrwkdaesgtpayqppynelkggeaqflvdyhdyymtprgyhpra vnsgnawtmttplsfmnmpiltyikeisprpillihgerahsryfsetayaaaaepkellivpgashvd lydrldripfdriagffdehl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.231
    Matthews' coefficent Rfactor 0.198
    Waters 194 Solvent Content

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2hdw
    1. The VSGB 2.0 model: A next generation energy model for high resolution protein structure modeling
    J Li, R Abel, K Zhu, Y Cao, S Zhao - Proteins: Structure, , 2011 - Wiley Online Library
     
    2. Progress in super long loop prediction
    S Zhao, K Zhu, J Li, RA Friesner - Proteins: Structure, Function, , 2011 - Wiley Online Library
     
    3. The structure of monoacylglycerol lipase from Bacillus sp. H257 reveals unexpected conservation of the cap architecture between bacterial and human enzymes
    S Rengachari, GA Bezerra, L Riegler-Berket - et Biophysica Acta (BBA , 2012 - Elsevier
     
    4. Towards High-resolution Computational Approaches for Structure-based Drug Discovery
    J Li - 2011 - academiccommons.columbia.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch