The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative translation repressor from Vibrio cholerae. To be Published
    Site NYSGXRC
    PDB Id 2haf Target Id NYSGXRC-2801c
    Molecular Characteristics
    Source Vibrio cholerae
    Alias Ids TPS7744,PF02622, ZP_01678038.1 Molecular Weight 21903.56 Da.
    Residues 198 Isoelectric Point 4.97
    Sequence snhssdievghsmnltnhflvampsmkdpyfkrsviyicehnqdgamglminapiditvggmlkqvdie paypqshqenlkkpvfnggpvsedrgfilhrprdhyessmkmtddiavttskdiltvlgteaepegyiv algysgwsagqleveltenswltieadpelifntpvhekwqkaiqklgispaqlssdagh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.88 Rfree 0.288
    Matthews' coefficent 2.57 Rfactor 0.241
    Waters 21 Solvent Content 52.13

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch