.
The Open Protein Structure Annotation Network
PDB Keyword
.

2fs2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure, Function, and Mechanism of the Phenylacetate Pathway Hot Dog-fold Thioesterase PaaI. J.Biol.Chem. 281 11028-11038 2006
    Site NYSGXRC
    PDB Id 2fs2 Target Id NYSGXRC-2763a
    Related PDB Ids 1psu 
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS7742,PF02575, NP_415914.1 Molecular Weight 14718.79 Da.
    Residues 139 Isoelectric Point 6.26
    Sequence shkawqnahamyendacakalgidiismdegfavvtmtvtaqmlnghqschggqlfsladtafayacns qglaavasactidflrpgfagdtltataqvrhqgkqtgvydieivnqqqktvalfrgkshriggtitgea
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.23
    Matthews' coefficent 2.51 Rfactor 0.187
    Waters 79 Solvent Content 50.92

    Ligand Information
    Ligands SO4 (SULFATE) x 3
    Metals

    Jmol

     
    Google Scholar output for 2fs2
    1. Structure, function, and mechanism of the phenylacetate pathway hot dog-fold thioesterase PaaI
    F Song, Z Zhuang, L Finci, D Dunaway-Mariano - Journal of Biological , 2006 - ASBMB
     
    2. Divergence of Function in the Hot Dog Fold Enzyme Superfamily: The Bacterial Thioesterase YciA
    Z Zhuang, F Song, H Zhao, L Li, J Cao, E Eisenstein - Biochemistry, 2008 - ACS Publications
     
    3. Thioesterases: A new perspective based on their primary and tertiary structures
    DC Cantu, Y Chen, PJ Reilly - Protein Science, 2010 - Wiley Online Library
     
    4. Analysis of proteins with the'hot dog'fold: Prediction of function and identification of catalytic residues of hypothetical proteins
    LS Pidugu, K Maity, K Ramaswamy - BMC structural , 2009 - biomedcentral.com
     
    5. Structure and function of a Campylobacter jejuni thioesterase Cj0915, a hexameric hot dog fold enzyme
    T Yokoyama, KJ Choi, AM Bosch, HJ Yeo - Biochimica et Biophysica Acta ( , 2009 - Elsevier
     
    6. Phylloquinone (Vitamin K1) Biosynthesis in Plants: Two Peroxisomal Thioesterases of Lactobacillales Origin Hydrolyze 1, 4_Dihydroxy_2_Naphthoyl_Coa
    JR Widhalm, AL Ducluzeau, NE Buller - The Plant , 2012 - Wiley Online Library
     
    7. Structure and activity of the Pseudomonas aeruginosa hotdog-fold thioesterases PA5202 and PA2801
    FG Claudio, T Anatoli, B Greg, F Robert, E Elena - Biochemical , 2012 - biochemj.org
     
    8. Structure and activity of the Pseudomonas aeruginosa hotdog-fold thioesterases PA5202 and PA2801
    CF Gonzalez, A Tchigvintsev, G Brown, R Flick - Biochemical , 2012 - 82.45.151.66
     
    9. Structure and activity of the {Less than} i {Greater than} Pseudomonas aeruginosa {Less than}/i {Greater than} hotdog-fold thioesterases PA5202 and PA2801
    C Gonzalez, A Tchigvintsev, G Brown, R Flick - 2012 - biochemj.org
     
    10. A Beginner's Guide to Molecular Structures
    S Porter - 2007 - books.google.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch