.
The Open Protein Structure Annotation Network
PDB Keyword
.
Blog
Tools
About
Logged in: Logged in as: Log in
Register

New Features

Quick Links

 

T. maritima Browser

TOPSAN > Proteins > NYSGXRC > 2b3v

2b3v

    Page last modified 08:27, 25 Sep 2010 by Admin
    Email link
    Page Notifications Off
    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structures of wild-type and mutant human spermidine/spermine N1-acetyltransferase, a potential therapeutic drug target. Proc.Natl.Acad.Sci.Usa 103 2063-2068 2006
    Site NYSGXRC
    PDB Id 2b3v Target Id NYSGXRC-9502a
    Related PDB Ids 2b3u 2b58 2b5g 2b4d 2b4b 
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS7853,NP_00296, PF00583 Molecular Weight 20022.95 Da.
    Residues 171 Isoelectric Point 5.09
    Sequence makfvirpataadcsdilrlikelakyeymeeqviltekdlledgfgehpfyhclvaevpkehwtpegh sivgfamyyftydpwigkllyledffvmsdyrgfgigseilknlsqvamrcrcssmhflvaewnepsin fykrrgasdlsseegwrlfkidkeyllkmatee
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.95 Rfree 0.257
    Matthews' coefficent 2.27 Rfactor 0.222
    Waters 59 Solvent Content 45.83

    Ligand Information
    Ligands ACO (ACETYL) x 1
    Metals

    Jmol

     
    Google Scholar output for 2b3v
    1. Structures of wild-type and mutant human spermidine/spermine N1-acetyltransferase, a potential therapeutic drug target
    MC Bewley, V Graziano, J Jiang - Proceedings of the , 2006 - National Acad Sciences
     
    2. Mechanistic and structural analysis of human spermidine/spermine N 1-acetyltransferase
    SS Hegde, J Chandler, MW Vetting, M Yu - Biochemistry, 2007 - ACS Publications
     

    Protein Summary


    Ligand Summary

    Reviews References Images Files Tags

    Reviews

    References

     

    No references found.

    Add tag
    Tag page
    • No tags
    What links here
    Attach file or image

    Files (0)

     
    Attach file or image

    Images (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch