2b3u

Page last modified 08:26, 25 Sep 2010 by Admin

Email link

Summary Discussions

Molecular Characteristics
Title	Structures of wild-type and mutant human spermidine/spermine N1-acetyltransferase, a potential therapeutic drug target. Proc.Natl.Acad.Sci.Usa 103 2063-2068 2006
Site	NYSGXRC
PDB Id	2b3u	Target Id	NYSGXRC-9502a
Related PDB Ids 2b58 2b5g 2b4d 2b3v 2b4b
Source	Homo sapiens
Alias Ids	TPS7852,NP_00296, PF00583	Molecular Weight	20022.95 Da.
Residues	171	Isoelectric Point	5.09
Sequence	makfvirpataadcsdilrlikelakyeymeeqviltekdlledgfgehpfyhclvaevpkehwtpegh sivgfamyyftydpwigkllyledffvmsdyrgfgigseilknlsqvamrcrcssmhflvaewnepsin fykrrgasdlsseegwrlfkidkeyllkmatee
	BLAST FFAS

Ligand Information
Ligands	SO4 (SULFATE) x 2
Metals

Google Scholar output for 2b3u
1. Structures of wild-type and mutant human spermidine/spermine N1-acetyltransferase, a potential therapeutic drug target
MC Bewley, V Graziano, J Jiang - Proceedings of the , 2006 - National Acad Sciences

2. Characterization of phosphorylation sites using 3D structural information
A Del Bonifro - 2010 - tesi.cab.unipd.it

Reviews References Images Files Tags

Reviews

No references found.

Add tag

Tag page

What links here

Attach file or image

Images 0
No images to display in the gallery.

You must login to post a comment.

All content on this site is licensed under a Creative Commons Attribution 3.0 License