1xxl

Page last modified 12:00, 25 Sep 2010 by Admin

Email link

Summary Discussions

Molecular Characteristics
Title	The crystal structure of YcgJ protein from Bacillus subitilis at 2.1 A resolution. To be Published
Site	NYSGXRC
PDB Id	1xxl	Target Id	NYSGXRC-T1761
Related PDB Ids 2glu
Source	Bacillus subtilis
Alias Ids	TPS8230,16077385	Molecular Weight	26962.97 Da.
Residues	238	Isoelectric Point	6.08
Sequence	mslglmiktaecraehrvldigagaghtalafspyvqecigvdatkemvevassfaqekgvenvrfqqg taeslpfpddsfdiitcryaahhfsdvrkavrevarvlkqdgrfllvdhyapedpvldefvnhlnrlrd pshvresslsewqamfsanqlayqdiqkwnlpiqydswikrggtpadrekqiithlnhasdeardtfci tlnqngqpisfclkailiqgikreghhhhhh
	BLAST FFAS

Ligand Information
Ligands	SO4 (SULFATE) x 8
Metals

Google Scholar output for 1xxl
1. Molecular phylogenetics and comparative modeling of HEN1, a methyltransferase involved in plant microRNA biogenesis
K Tkaczuk, A Obarska, J Bujnicki - BMC evolutionary biology, 2006 - biomedcentral.com

2. Bud23 methylates G1575 of 18S rRNA and is required for efficient nuclear export of pre-40S subunits
J White, Z Li, R Sardana, JM Bujnicki - and cellular biology, 2008 - Am Soc Microbiol

Reviews References Images Files Tags

Reviews

No references found.

Add tag

Tag page

What links here

Attach file or image

Images 0
No images to display in the gallery.

You must login to post a comment.

All content on this site is licensed under a Creative Commons Attribution 3.0 License