.
The Open Protein Structure Annotation Network
PDB Keyword
.

1r3d

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    Title Structural Genomics target NYSGRC-T920 related to A/B hydrolase fold. To be Published
    Site NYSGXRC
    PDB Id 1r3d Target Id NYSGXRC-T920
    Molecular Characteristics
    Source Vibrio cholerae
    Alias Ids TPS8153,Q9KQM4 Molecular Weight 28968.40 Da.
    Residues 263 Isoelectric Point 6.36
    Sequence mlsnqlhfakptartplvvlvhgllgsgadwqpvlshlartqcaaltldlpghgtnperhcdnfaeave mieqtvqahvtsevpvilvgyslggrlimhglaqgafsrlnlrgaiiegghfglqeneekaarwqhdqq waqrfsqqpiehvlsdwyqqavfsslnheqrqtliaqrsanlgssvahmllatslakqpyllpalqalk lpihyvcgeqdskfqqlaessglsysqvaqaghnvhheqpqafakivqamihsiid
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.21554
    Matthews' coefficent 2.26 Rfactor 0.17932
    Waters 164 Solvent Content 45.60

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch