.
The Open Protein Structure Annotation Network
PDB Keyword
.

1q98

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    Title Structure of a Thiol Peroxidase from Haemophilus influenzae Rd. To be Published
    Site NYSGXRC
    PDB Id 1q98 Target Id NYSGXRC-T1429
    Molecular Characteristics
    Source Haemophilus influenzae rd
    Alias Ids TPS8163,Q57549 Molecular Weight 17625.10 Da.
    Residues 165 Isoelectric Point 4.97
    Sequence mtvtlagnpievgghfpqvgeivenfilvgndladvalndfaskrkvlnifpsidtgvcatsvrkfnqq aaklsntivlcisadlpfaqarfcgaegienaktvstfrnhalhsqlgvdiqtgplagltsravivlde qnnvlhsqlveeikeepnyeaalavla
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.267
    Matthews' coefficent 2.07 Rfactor 0.225
    Waters 275 Solvent Content 40.10

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch