| Title | X-ray structure of monoamine oxidase regulatory protein from Archaeoglobus fulgidus. To be Published | | Site | NYSGXRC | | PDB Id | | Target Id | NYSGXRC-T805 | | Molecular Characteristics | | Source | Archaeoglobus fulgidus. | | Alias Ids | TPS8138,O28346 | Molecular Weight | 18086.09 Da. | | Residues | 161 | Isoelectric Point | 5.46 | | Sequence | mdfpriimarnpiyfesiqigekieglprtvtetdiwtfayltadffplhtdvefakktifgkpiaqgm lvlsialgmvdqvilsnydvssviaffgikdvrflrpvfigdtiaasaevvekqdfdeksgvvtyklev knqrgelvltalysalirktpsk | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 12 | | Resolution (Å) | 2.81 | Rfree | 0.276 | | Matthews' coefficent | 2.58 | Rfactor | 0.242 | | Waters | | Solvent Content | 50.49 |
| Ligand Information | | Ligands | | | Metals | | | |
