| Title | Crystal structure of the protein YJCF from Bacillus subtilis: a member of the GCN5-related N-acetyltransferase superfamily. To be Published | | Site | NYSGXRC | | PDB Id | | Target Id | NYSGXRC-T804 | | Molecular Characteristics | | Source | Bacillus subtilis | | Alias Ids | TPS8137,O31628 | Molecular Weight | 15667.14 Da. | | Residues | 140 | Isoelectric Point | 5.64 | | Sequence | mkaviakneeqlkdafyvreevfvkeqnvpaeeeidelenesehivvydgekpvgagrwrmkdgygkle ricvlkshrsagvggiimkalekaaadggasgfilnaqtqavpfykkhgyrvlsekefldagiphlqmm kd | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 2.00 | Rfree | 0.265 | | Matthews' coefficent | 2.33 | Rfactor | 0.234 | | Waters | 36 | Solvent Content | 45.13 |
| Ligand Information | | Ligands | | | Metals | | | |
