.
The Open Protein Structure Annotation Network
PDB Keyword
.

1pv1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    Title Structural characterization and reversal of the natural organophosphate resistance of a D-type esterase, Saccharomyces cerevisiae S-formylglutathione hydrolase. Biochemistry 47 9592-9601 2008
    Site NYSGXRC
    PDB Id 1pv1 Target Id NYSGXRC-P068
    Molecular Characteristics
    Source Saccharomyces cerevisiae
    Alias Ids TPS8069,P40363 Molecular Weight 33932.51 Da.
    Residues 299 Isoelectric Point 6.22
    Sequence mkvvkefsvcggrliklshnsnstktsmnvniylpkhyyaqdfprnkriptvfylsgltctpdnaseka fwqfqadkygfaivfpdtsprgdevandpegswdfgqgagfylnatqepyaqhyqmydyihkelpqtld shfnkngdvkldfldnvaitghsmggygaicgylkgysgkrykscsafapivnpsnvpwgqkafkgylg eekaqweaydpclliknirhvgddrilihvgdsdpfleehlkpellleavkatswqdyveikkvhgfdh syyfvstfvpehaefharnlgli
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.30 Rfree 0.2982
    Matthews' coefficent 2.57 Rfactor 0.255
    Waters 122 Solvent Content 52.13

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch