.
The Open Protein Structure Annotation Network
PDB Keyword
.

1pug

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    Title Structure of E. coli Ybab. To be Published
    Site NYSGXRC
    PDB Id 1pug Target Id NYSGXRC-T5
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS8082,P17577 Molecular Weight 12014.24 Da.
    Residues 109 Isoelectric Point 5.01
    Sequence mfgkgglgnlmkqaqqmqekmqkmqeeiaqlevtgesgaglvkvtingahncrrveidpslleddkeml edlvaaafndaarrieetqkekmasvssgmqlppgfkmpf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.20 Rfree 0.28412
    Matthews' coefficent 3.13 Rfactor 0.21211
    Waters 163 Solvent Content 60.46

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch