| Title | Structure of E. coli ADP-heptose lps heptosyltransferase II. To be Published | | Site | NYSGXRC | | PDB Id | | Target Id | NYSGXRC-T832 | | Molecular Characteristics | | Source | Neisseria gonorrhoeae. | | Alias Ids | TPS8144,Q51063 | Molecular Weight | 40262.18 Da. | | Residues | 359 | Isoelectric Point | 6.96 | | Sequence | slkilvigpswvgdmmmsqslyrtlqarypqaiidvmapawcrpllsrmpevneaipmplghgaleige rrklghslrekrydrayvlpnsfksalvpffagiphrtgwrgemrygllndvrvldkeawplmveryia laydkgimrtaqdlpqpllwpqlqvsegeksytcnqfslsserpmigfcpgaefgpakrwphyhyaela kqlidegyqvvlfgsakdheagneilaalnteqqawcrnlagetqldqaviliaackaivtndsglmhv aaalnrplvalygpsspdftpplshkarvirlitgyhkvrkgdaaegyhqsliditpqrvleelnalll qeeaeggshhhhhh | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 2.00 | Rfree | 0.225 | | Matthews' coefficent | 2.91 | Rfactor | 0.201 | | Waters | 283 | Solvent Content | 57.40 |
| Ligand Information | | Ligands | | | Metals | | | |
