| Title | Structure of the E. coli PaaI protein from the phyenylacetic acid degradation operon. To be Published | | Site | NYSGXRC | | PDB Id | | Target Id | NYSGXRC-2763a | | Related PDB Ids 2fs2 | | Molecular Characteristics | | Source | Escherichia coli | | Alias Ids | TPS9399,PF02575, NP_415914.1 | Molecular Weight | 14718.79 Da. | | Residues | 139 | Isoelectric Point | 6.26 | | Sequence | shkawqnahamyendacakalgidiismdegfavvtmtvtaqmlnghqschggqlfsladtafayacns qglaavasactidflrpgfagdtltataqvrhqgkqtgvydieivnqqqktvalfrgkshriggtitgea | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 2.20 | Rfree | 0.251 | | Matthews' coefficent | 2.75 | Rfactor | 0.22 | | Waters | 143 | Solvent Content | 54.90 |
| Ligand Information | | Ligands | | | Metals | | | |
