| Title | Structure of a probable thiol peroxidase from Streptococcus pneumoniae. To be Published | | Site | NYSGXRC | | PDB Id | | Target Id | NYSGXRC-T817 | | Molecular Characteristics | | Source | Streptococcus pneumoniae. | | Alias Ids | TPS8140,P72500 | Molecular Weight | 18018.43 Da. | | Residues | 163 | Isoelectric Point | 4.72 | | Sequence | mvtflgnpvsftgkqlqvgdkaldfsltttdlskksladfdgkkkvlsvvpsidtgicstqtrrfneel agldntvvltvsmdlpfaqkrwcgaegldnaimlsdyfdhsfgrdyallinewhllaravfvldtdnti ryveyvdninsepnfeaaiaaakal | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 2.30 | Rfree | 0.249 | | Matthews' coefficent | 2.37 | Rfactor | 0.2 | | Waters | 253 | Solvent Content | 47.70 |
| Ligand Information | | Ligands | | | Metals | | | |
