.
The Open Protein Structure Annotation Network
PDB Keyword
.

1pb6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of hypothetical transcriptional regulator ycdC from Escherichia coli. To be Published
    Site NYSGXRC
    PDB Id 1pb6 Target Id NYSGXRC-T803
    Molecular Characteristics
    Source Escherichia coli.
    Alias Ids TPS8136,P75899 Molecular Weight 23686.29 Da.
    Residues 212 Isoelectric Point 8.92
    Sequence mtqgavkttgkrsravsakkkailsaaldtfsqfgfhgtrleqiaelagvsktnllyyfpskealyiav lrqildiwlaplkafredfaplaaikeyirlklevsrdypqasrlfcmemlagapllmdeltgdlkali deksaliagwvksgklapidpqhlifmiwastqhyadfapqveavtgatlrdevffnqtvenvqriiie girpr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.50 Rfree 0.277
    Matthews' coefficent 3.15 Rfactor 0.238
    Waters 160 Solvent Content 60.60

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch