| Title | Structure of the Periplasmic divalent cation tolerance protein CutA from Archaeoglobus fulgidus. To be Published 2003 | | Site | NYSGXRC | | PDB Id | | Target Id | NYSGXRC-T835 | | Molecular Characteristics | | Source | Archaeoglobus fulgidus. | | Alias Ids | TPS8146,O28301 | Molecular Weight | 11884.22 Da. | | Residues | 102 | Isoelectric Point | 5.47 | | Sequence | mhnfiyitapsleeaeriakrllekklaacvnifpiksffwwegkieaatefamivktrsekfaevrde vkamhsyttpcicaipierglkefldwidetve | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 2.00 | Rfree | 0.229 | | Matthews' coefficent | 2.51 | Rfactor | 0.207 | | Waters | 56 | Solvent Content | 50.60 |
| Ligand Information | | Ligands | | | Metals | | | |
