.
The Open Protein Structure Annotation Network
PDB Keyword
.

1nvt

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    Title Crystal structure of shikimate 5-dehydrogenase (SDH) bound to NADP: insights into function and evolution. Structure 11 1005-1013 2003
    Site NYSGXRC
    PDB Id 1nvt Target Id NYSGXRC-T576
    Molecular Characteristics
    Source Methanococcus jannaschii.
    Alias Ids TPS8113,Q58484 Molecular Weight 30875.44 Da.
    Residues 282 Isoelectric Point 5.56
    Sequence minaktkviglighpvehsfspimhnaafkdkglnyvyvafdvlpenlkyvidgakalgivgfnvtiph kieimkyldeidkdaqligavntikiedgkaigyntdgigarmaleeeigrvkdkniviygaggaarav afelakdnniiianrtvekaealakeiaeklnkkfgeevkfsgldvdldgvdiiinatpigmypnidve pivkaeklredmvvmdliynpletvllkeakkvnaktinglgmliyqgavafkiwtgvepnievmknai idkitk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.35 Rfree 0.26
    Matthews' coefficent 2.58 Rfactor 0.224
    Waters 139 Solvent Content 51.98

    Ligand Information
    Ligands NAP (NADP) x 2
    Metals ZN (ZINC) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch