| Title | Structural and functional analysis of the costimulatory receptor programmed death-1. Immunity 20 337-347 2004 | | Site | NYSGXRC | | PDB Id | | Target Id | NYSGXRC-T749 | | Molecular Characteristics | | Source | Homo sapiens | | Alias Ids | TPS8119,Q15116 | Molecular Weight | 13164.05 Da. | | Residues | 117 | Isoelectric Point | 5.28 | | Sequence | sltfypawltvseganatftcslsnwsedlmlnwnrlspsnqtekqaafsnglsqpvqdarfqiiqlpn rhdfhmnildtrrndsgiylcgaislhpkakieespgaelvvterile | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 2.00 | Rfree | 0.228 | | Matthews' coefficent | 1.67 | Rfactor | 0.198 | | Waters | 73 | Solvent Content | 25.80 |
| Ligand Information | | Ligands | | | Metals | | | |
