.
The Open Protein Structure Annotation Network
PDB Keyword
.

1nlx

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    Title Crystal Structure oh Phl p 6, a major timothy grass pollen allergen co-crystallized with Zinc. To be Published
    Site NYSGXRC
    PDB Id 1nlx Target Id NYSGXRC-T746
    Molecular Characteristics
    Source Phleum pratense
    Alias Ids TPS8118,P43215 Molecular Weight 13920.02 Da.
    Residues 132 Isoelectric Point 5.31
    Sequence mvamflavavvlglatsptaeggkatteeqkliedvnasfraamattanvppadkyktfeaaftvsskr nladavskapqlvpkldevynaaynaadhaapedkyeafvlhfsealriiagtpevhavkpga
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 14
    Resolution (Å) 2.80 Rfree 0.272
    Matthews' coefficent 2.85 Rfactor 0.243
    Waters Solvent Content 55.19

    Ligand Information
    Ligands ARS (ARSENIC) x 7
    Metals ZN (ZINC) x 28

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch