.
The Open Protein Structure Annotation Network
PDB Keyword
.

1njr

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    Title Structure and mechanism of ADP-ribose-1''-monophosphatase (Appr-1''-pase), a ubiquitous cellular processing enzyme. Protein Sci. 14 719-726 2005
    Site NYSGXRC
    PDB Id 1njr Target Id NYSGXRC-P089
    Related PDB Ids 1txz 1ty8 
    Molecular Characteristics
    Source Saccharomyces cerevisiae
    Alias Ids TPS8070,Q04299 Molecular Weight 32065.55 Da.
    Residues 284 Isoelectric Point 7.17
    Sequence mtgslnrhsllngvkkmriilcdtnevvtnlwqesiphayiqndkylcihhghlqslmdsmrkgdaihh ghsyaivspgnsygylgggfdkalynyfggkpfetwfrnqlggryhtvgsatvvdlqrcleektiecrd giryiihvptvvapsapifnpqnplktgfepvfnamwnalmhspkdidgliipglctgyagvppiisck smafalrlymagdhiskelknvlimyylqypfepffpesckiecqklgidiemlksfnvekdaiellip rriltldl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.23
    Matthews' coefficent 1.89 Rfactor 0.206
    Waters 112 Solvent Content 34.91

    Ligand Information
    Ligands XYL (D-XYLITOL) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch