| Title | X-ray Crystal Structure of Phl p 1, a Major Timothy Grass Pollen Allergen. To be Published | | Site | NYSGXRC | | PDB Id | | Target Id | NYSGXRC-T1467 | | Molecular Characteristics | | Source | Phleum pratense (common timothy) | | Alias Ids | TPS8169,P43213 | Molecular Weight | 28455.75 Da. | | Residues | 263 | Isoelectric Point | 6.14 | | Sequence | massssvllvvvlfavflgsaygipkvppgpnitatygdkwldakstwygkptgagpkdnggacgykdv dkppfsgmtgcgntpifksgrgcgscfeikctkpeacsgepvvvhitddneepiapyhfdlsghafgam akkgdeqklrsagelelqfrrvkckypegtkvtfhvekgsnpnylallvkyvngdgdvvavdikekgkd kwielkeswgaiwridtpdkltgpftvrytteggtkteaedvipegwkadtsyesk | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 2.90 | Rfree | 0.267 | | Matthews' coefficent | 2.58 | Rfactor | 0.239 | | Waters | | Solvent Content | 50.56 |
| Ligand Information | | Ligands | NAG (N-ACETYL-D-GLUCOSAMINE) x 2 | | Metals | | | |
