.
The Open Protein Structure Annotation Network
PDB Keyword
.

1lx7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    Title Structure of Escherichia coli uridine phosphorylase at 2.0 A. Acta Crystallogr.,Sect.D 59 73-76 2003
    Site NYSGXRC
    PDB Id 1lx7 Target Id NYSGXRC-T24
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS8087,P12758 Molecular Weight 27026.43 Da.
    Residues 252 Isoelectric Point 5.81
    Sequence sksdvfhlgltkndlqgatlaivpgdpdrvekiaalmdkpvklashrefttwraeldgkpvivcstgig gpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslhfaplefpavadfectta lveaaksigatthvgvtassdtfypgqerydtysgrvvrhfkgsmeewqamgvmnyemesatlltmcas qglragmvagvivnrtqqeipnaetmkqteshavkivveaarrll
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.215
    Matthews' coefficent 1.93 Rfactor 0.182
    Waters 361 Solvent Content 36.11

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch