.
The Open Protein Structure Annotation Network
PDB Keyword
.

1l9g

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    Title Crystal Structure of uracil-DNA glycosylase from T. Maritima. To be Published
    Site NYSGXRC
    PDB Id 1l9g Target Id NYSGXRC-T299
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS8108,Q9WYY1 Molecular Weight 21499.79 Da.
    Residues 192 Isoelectric Point 8.60
    Sequence mytreelmeivservkkctacplhlnrtnvvvgegnldtrivfvgegpgeeedktgrpfvgragmllte llresgirredvyicnvvkcrppnnrtptpeeqaacghfllaqieiinpdvivalgatalsffvdgkkv sitkvrgnpidwlggkkviptfhpsyllrnrsnelrrivlediekaksfikkeg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.50 Rfree 0.2808
    Matthews' coefficent 2.70 Rfactor 0.226
    Waters 65 Solvent Content 54.60

    Ligand Information
    Ligands SO4 (SULFATE) x 1;SF4 (IRON/SULFUR) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch