.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ku9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    Title X-ray structure of an M. jannaschii DNA-binding protein: implications for antibiotic resistance in S. aureus. Proteins 50 170-173 2002
    Site NYSGXRC
    PDB Id 1ku9 Target Id NYSGXRC-T136
    Molecular Characteristics
    Source Methanococcus jannaschii
    Alias Ids TPS8103,Q58958 Molecular Weight 17607.78 Da.
    Residues 152 Isoelectric Point 8.44
    Sequence miimeeakkliielfselakihglnksvgavyailylsdkpltisdimeelkiskgnvsmslkkleelg fvrkvwikgerknyyeavdgfssikdiakrkhdliaktyedlkkleekcneeekefikqkikgiermkk isekilealndldn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.80 Rfree 0.28
    Matthews' coefficent 2.74 Rfactor 0.241
    Waters 86 Solvent Content 55.15

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch