| Title | Crystal structure of the Escherichia coli shikimate kinase I (AroK) that confers sensitivity to mecillinam. Proteins 47 558-562 2002 | | Site | NYSGXRC | | PDB Id | | Target Id | NYSGXRC-T535 | | Molecular Characteristics | | Source | Escherichia coli | | Alias Ids | TPS8112,P24167 | Molecular Weight | 19405.87 Da. | | Residues | 172 | Isoelectric Point | 5.26 | | Sequence | aekrniflvgpmgagkstigrqlaqqlnmefydsdqeiekrtgadvgwvfdlegeegfrdreekvinel tekqgivlatgggsvksretrnrlsargvvvylettiekqlartqrdkkrpllhvetpprevlealane rnplyeeiadvtirtddqsakvvanqiihmlesn | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 2.05 | Rfree | 0.2710000 | | Matthews' coefficent | 1.97 | Rfactor | 0.2170000 | | Waters | 258 | Solvent Content | 37.43 |
| Ligand Information | | Ligands | | | Metals | | | |
