| Title | Crystal Structure Analysis of the Human C-Terminal CAP1-Adenylyl Cyclase Associated Protein. To be Published | | Site | NYSGXRC | | PDB Id | | Target Id | NYSGXRC-T139 | | Molecular Characteristics | | Source | Homo sapiens | | Alias Ids | TPS8105,Q01518 | Molecular Weight | 17343.10 Da. | | Residues | 157 | Isoelectric Point | 5.09 | | Sequence | pavlelegkkwrvenqenvsnlviedtelkqvayiykcvnttlqikgkinsitvdnckklglvfddvvg iveiinskdvkvqvmgkvptisinktdgchaylsknsldceivsakssemnvlipteggdfnefpvpeq fktlwngqklvttvteiag | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 4 | | Resolution (Å) | 2.80 | Rfree | 0.268 | | Matthews' coefficent | 2.38 | Rfactor | 0.232 | | Waters | | Solvent Content | 47.10 |
| Ligand Information | | Ligands | | | Metals | | | |
