.
The Open Protein Structure Annotation Network
PDB Keyword
.

1jzt

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    Title Crystal Structure of Yeast Hypothetical Protein YNU0_YEAST. To be Published
    Site NYSGXRC
    PDB Id 1jzt Target Id NYSGXRC-P097
    Molecular Characteristics
    Source Saccharomyces cerevisiae
    Alias Ids TPS8074,P40165 Molecular Weight 27519.53 Da.
    Residues 246 Isoelectric Point 8.52
    Sequence mstlkvvssklaaeidkelmgpqigftlqqlmelagfsvaqavcrqfplrgktetekgkhvfviagpgn nggdglvcarhlklfgynpvvfypkrsertefykqlvhqlnffkvpvlsqdegnwleylkpektlcivd aifgfsfkppmrepfkgiveelckvqniipivsvdvptgwdvdkgpisqpsinpavlvsltvpkpcssh irenqtthyvggrfiprdfankfgfepfgyestdqilkl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.94 Rfree 0.2370000
    Matthews' coefficent 2.29 Rfactor 0.2000000
    Waters 309 Solvent Content 0.46

    Ligand Information
    Ligands
    Metals CL (CHLORIDE) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch