| Title | Crystal structure of the Escherichia coli SbmC protein that protects cells from the DNA replication inhibitor microcin B17. Proteins 47 403-407 2002 | | Site | NYSGXRC | | PDB Id | | Target Id | NYSGXRC-T473 | | Molecular Characteristics | | Source | Escherichia coli | | Alias Ids | TPS8109,P33012 | Molecular Weight | 18080.63 Da. | | Residues | 157 | Isoelectric Point | 4.61 | | Sequence | mnyeikqeekrtvagfhlvgpweqtvkkgfeqlmmwvdsknivpkewvavyydnpdetpaeklrcdtvv tvpgyftlpensegvilteitggqyavavarvvgddfakpwyqffnsllqdsayemlpkpcfevylnng aedgywdiemyvavqpkhh | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 1.80 | Rfree | 0.2220000 | | Matthews' coefficent | 2.93 | Rfactor | 0.1960000 | | Waters | 177 | Solvent Content | 58.02 |
| Ligand Information | | Ligands | | | Metals | | | |
