| Title | Crystal structure of the Escherichia coli glucose-inhibited division protein B (GidB) reveals a methyltransferase fold. Proteins 47 563-567 2002 | | Site | NYSGXRC | | PDB Id | | Target Id | NYSGXRC-T35 | | Molecular Characteristics | | Source | Escherichia coli | | Alias Ids | TPS8089,P17113 | Molecular Weight | 23429.91 Da. | | Residues | 207 | Isoelectric Point | 6.06 | | Sequence | mlnklslllkdagisltdhqknqliayvnmlhkwnkaynltsvrdpnemlvrhildsivvapylqgerf idvgtgpglpgiplsivrpeahftlldslgkrvrflrqvqhelkleniepvqsrveefpseppfdgvis rafaslndmvswchhlpgeqgrfyalkgqmpedeiallpeeyqvesvvklqvpaldgerhlvvikanki | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 2.40 | Rfree | 0.2750000 | | Matthews' coefficent | 2.33 | Rfactor | 0.2400000 | | Waters | 127 | Solvent Content | 47.23 |
| Ligand Information | | Ligands | | | Metals | | | |
