.
The Open Protein Structure Annotation Network
PDB Keyword
.

1jr7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    Title Structural genomics: a pipeline for providing structures for the biologist. Protein Sci. 11 723-738 2002
    Site NYSGXRC
    PDB Id 1jr7 Target Id NYSGXRC-T130
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS8098,P76621 Molecular Weight 37358.53 Da.
    Residues 325 Isoelectric Point 5.77
    Sequence mnaltavqnnavdsgqdysgftltpsaqsprlleltfteqttkqfleqvaewpvqaleyksflrfrvak ilddlcanqlqplllktllnraegallinavgvddvkqademvklatavahligrsnfdamsgqyyarf vvknvdnsdsylrqphrvmelhndgtyveeitdyvlmmkideqnmqggnslllhlddwehldnyfrhpl arrpmrfaappsknvskdvfhpvfdvdqqgrpvmryidqfvqpkdfeegvwlselsdaietskgilsvp vpvgkfllinnlfwlhgrdrftphpdlrrelmrqrgyfayasnhyqthq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.2400000
    Matthews' coefficent 3.44 Rfactor 0.1930000
    Waters 320 Solvent Content 64.28

    Ligand Information
    Ligands
    Metals FE2 (FE) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch