| Title | Crystal Structure of Low-specificity Threonine Aldolase, a Key Enzyme in Glycine Biosynthesis. To be published | | Site | NYSGXRC | | PDB Id | | Target Id | NYSGXRC-P044a | | Related PDB Ids 1lw5 1lw4 | | Molecular Characteristics | | Source | Thermotoga maritima | | Alias Ids | TPS8065,Q9X266 | Molecular Weight | 37572.08 Da. | | Residues | 343 | Isoelectric Point | 6.23 | | Sequence | midlrsdtvtkpteemrkamaqaevgddvygedptinelerlaaetfgkeaalfvpsgtmgnqvsimah tqrgdevileadshifwyevgamavlsgvmphpvpgkngamdpddvrkairprnihfprtsliaienth nrsggrvvplenikeictiakehginvhidgarifnasiasgvpvkeyagyadsvmfclskglcapvgs vvvgdrdfierarkarkmlgggmrqagvlaaagiialtkmvdrlkedhenarflalklkeigysvnped vktnmvilrtdnlkvnahgfiealrnsgvlanavsdteirlvthkdvsrndieealnifeklfrkfs | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 4 | | Resolution (Å) | 1.80 | Rfree | 0.222 | | Matthews' coefficent | 2.36 | Rfactor | 0.207 | | Waters | 841 | Solvent Content | 47.85 |
| Ligand Information | | Ligands | | | Metals | NA (SODIUM) x 2;CA (CALCIUM) x 6 | | |
